![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
![]() | Domain d1yedl2: 1yed L:111-222 [21178] Other proteins in same PDB: d1yeda1, d1yedb1, d1yedb2, d1yedh1, d1yedh2, d1yedl1 |
PDB Entry: 1yed (more details), 3.1 Å
SCOP Domain Sequences for d1yedl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yedl2 b.1.1.2 (L:111-222) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yedl2: