| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries) Uniprot P08263 |
| Domain d3ik9d1: 3ik9 D:2-80 [211767] Other proteins in same PDB: d3ik9a2, d3ik9b2, d3ik9c2, d3ik9d2, d3ik9e2, d3ik9f2, d3ik9g2, d3ik9h2 automated match to d1k3ya2 complexed with bob |
PDB Entry: 3ik9 (more details), 2.2 Å
SCOPe Domain Sequences for d3ik9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ik9d1 c.47.1.5 (D:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn
Timeline for d3ik9d1: