Lineage for d3ik9c1 (3ik9 C:2-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368672Protein Class alpha GST [81360] (8 species)
  7. 1368687Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (28 PDB entries)
    Uniprot P08263
  8. 1368724Domain d3ik9c1: 3ik9 C:2-80 [211765]
    Other proteins in same PDB: d3ik9a2, d3ik9b2, d3ik9c2, d3ik9d2, d3ik9e2, d3ik9f2, d3ik9g2, d3ik9h2
    automated match to d1k3ya2
    complexed with bob

Details for d3ik9c1

PDB Entry: 3ik9 (more details), 2.2 Å

PDB Description: human gst a1-1-gimf with gsdhn
PDB Compounds: (C:) glutathione s-transferase a1

SCOPe Domain Sequences for d3ik9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik9c1 c.47.1.5 (C:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d3ik9c1:

Click to download the PDB-style file with coordinates for d3ik9c1.
(The format of our PDB-style files is described here.)

Timeline for d3ik9c1: