![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
![]() | Domain d3ik7d2: 3ik7 D:81-221 [211760] Other proteins in same PDB: d3ik7a1, d3ik7b1, d3ik7c1, d3ik7d1 automated match to d1gula1 complexed with bob, so4 |
PDB Entry: 3ik7 (more details), 1.97 Å
SCOPe Domain Sequences for d3ik7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ik7d2 a.45.1.1 (D:81-221) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep gskkkpppdeiyvrtvynifr
Timeline for d3ik7d2: