Lineage for d3ik7d1 (3ik7 D:2-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1600825Protein Class alpha GST [81360] (8 species)
  7. 1600838Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
    Uniprot P08263
  8. 1600858Domain d3ik7d1: 3ik7 D:2-80 [211759]
    Other proteins in same PDB: d3ik7a2, d3ik7b2, d3ik7c2, d3ik7d2
    automated match to d1gula2
    complexed with bob, so4

Details for d3ik7d1

PDB Entry: 3ik7 (more details), 1.97 Å

PDB Description: human glutathione transferase a4-4 with gsdhn
PDB Compounds: (D:) Glutathione S-transferase A4

SCOPe Domain Sequences for d3ik7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik7d1 c.47.1.5 (D:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveid
gmklvqtrsilhyiadkhn

SCOPe Domain Coordinates for d3ik7d1:

Click to download the PDB-style file with coordinates for d3ik7d1.
(The format of our PDB-style files is described here.)

Timeline for d3ik7d1: