| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Herpetosiphon aurantiacus [TaxId:316274] [225737] (1 PDB entry) |
| Domain d3ik4c1: 3ik4 C:0-126 [211749] Other proteins in same PDB: d3ik4a2, d3ik4b2, d3ik4c2, d3ik4d2 automated match to d1jpma2 complexed with gol, k |
PDB Entry: 3ik4 (more details), 2.1 Å
SCOPe Domain Sequences for d3ik4c1:
Sequence, based on SEQRES records: (download)
>d3ik4c1 d.54.1.0 (C:0-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
slpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsge
tqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmp
lhvffgg
>d3ik4c1 d.54.1.0 (C:0-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
slpttiqaisaeainlplteavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaai
erlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffgg
Timeline for d3ik4c1: