Lineage for d3ik4a2 (3ik4 A:127-358)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344193Species Herpetosiphon aurantiacus [TaxId:316274] [225738] (1 PDB entry)
  8. 1344194Domain d3ik4a2: 3ik4 A:127-358 [211746]
    Other proteins in same PDB: d3ik4a1, d3ik4b1, d3ik4c1, d3ik4d1
    automated match to d1jpma1
    complexed with gol, k

Details for d3ik4a2

PDB Entry: 3ik4 (more details), 2.1 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from herpetosiphon aurantiacus
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3ik4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik4a2 c.1.11.0 (A:127-358) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
vskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaapta
plivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaades
arsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfs
anlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh

SCOPe Domain Coordinates for d3ik4a2:

Click to download the PDB-style file with coordinates for d3ik4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ik4a2: