SCOPe 2.08: Domain d3ijsa2: 3ijs A:107-212

Lineage for d3ijsa2 (3ijs A:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3ijsa2: 3ijs A:107-212 [211736]
   Other proteins in same PDB: d3ijsa1, d3ijsb_, d3ijsc1, d3ijsd_
   automated match to d1dqdl2
   complexed with mg

Details for d3ijsa2

PDB Entry: 3ijs, 2.55 Å

PDB Description: structure of s67-27 in complex with tsbp

PDB Compounds: (A:) Immunoglobulin light chain (IGG3)

SCOPe Domain Sequences for d3ijsa2:

Sequence; same for both SEQRES and ATOM records:

>d3ijsa2 b.1.1.2 (A:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3ijsa2:

• d3ijsa2 first appeared in SCOPe 2.03
  
• d3ijsa2 appears in SCOPe 2.07