SCOPe 2.07: Domain d3ijsa1: 3ijs A:2-106

Lineage for d3ijsa1 (3ijs A:2-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (598 PDB entries)

8. Domain d3ijsa1: 3ijs A:2-106 [211735]
   Other proteins in same PDB: d3ijsa2, d3ijsc2
   automated match to d1dqdl1
   complexed with mg

Details for d3ijsa1

PDB Entry: 3ijs, 2.55 Å

PDB Description: Structure of S67-27 in Complex with TSBP

PDB Compounds: (A:) Immunoglubilin light chain (IGG3)

SCOPe Domain Sequences for d3ijsa1:

Sequence; same for both SEQRES and ATOM records:

>d3ijsa1 b.1.1.0 (A:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleik

Timeline for d3ijsa1:

• d3ijsa1 first appeared in SCOPe 2.03
  
• d3ijsa1 appears in SCOPe 2.06