| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3ijsa1: 3ijs A:2-106 [211735] Other proteins in same PDB: d3ijsa2, d3ijsb_, d3ijsc2, d3ijsd_ automated match to d1dqdl1 complexed with mg |
PDB Entry: 3ijs (more details), 2.55 Å
SCOPe Domain Sequences for d3ijsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijsa1 b.1.1.0 (A:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleik
Timeline for d3ijsa1:
View in 3DDomains from other chains: (mouse over for more information) d3ijsb_, d3ijsc1, d3ijsc2, d3ijsd_ |