Lineage for d1yeih2 (1yei H:114-223)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8896Species Fab D2.3 (mouse), kappa L chain [49045] (4 PDB entries)
  8. 8899Domain d1yeih2: 1yei H:114-223 [21173]
    Other proteins in same PDB: d1yeih1, d1yeil1

Details for d1yeih2

PDB Entry: 1yei (more details), 1.9 Å

PDB Description: catalytic antibody d2.3 complex

SCOP Domain Sequences for d1yeih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeih2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1yeih2:

Click to download the PDB-style file with coordinates for d1yeih2.
(The format of our PDB-style files is described here.)

Timeline for d1yeih2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yeih1