Lineage for d3ijrb_ (3ijr B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2106940Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 2106948Domain d3ijrb_: 3ijr B: [211728]
    Other proteins in same PDB: d3ijrf2, d3ijrh2
    automated match to d1g0oc_
    complexed with mg, nad, so4

Details for d3ijrb_

PDB Entry: 3ijr (more details), 2.05 Å

PDB Description: 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad+
PDB Compounds: (B:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3ijrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijrb_ c.2.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
nfvtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigravsiafa
keganiaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrqlgslni
lvnnvaqqypqqgleyitaeqlektfrinifsyfhvtkaalshlkqgdviintasivaye
gnetlidysatkgaivaftrslsqslvqkgirvngvapgpiwtplipssfdekkvsqfgs
nvpmqrpgqpyelapayvylassdssyvtgqmihvnggvivng

SCOPe Domain Coordinates for d3ijrb_:

Click to download the PDB-style file with coordinates for d3ijrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ijrb_: