SCOPe 2.07: Domain d3ij9a2: 3ij9 A:404-496

Lineage for d3ij9a2 (3ij9 A:404-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d3ij9a2: 3ij9 A:404-496 [211722]
   Other proteins in same PDB: d3ij9a1
   automated match to d1hnya1
   complexed with b0d, ca, cl

Details for d3ij9a2

PDB Entry: 3ij9, 1.85 Å

PDB Description: directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3ij9a2:

Sequence; same for both SEQRES and ATOM records:

>d3ij9a2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d3ij9a2:

• d3ij9a2 first appeared in SCOPe 2.03
  
• d3ij9a2 appears in SCOPe 2.06
  
• d3ij9a2 appears in the current release, SCOPe 2.08