Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Histone macro-H2a1.1 [142547] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142549] (6 PDB entries) Uniprot O75367 179-367! Uniprot O75367 181-371 |
Domain d3iifb_: 3iif B: [211710] automated match to d2fxka1 protein/DNA complex; complexed with apr |
PDB Entry: 3iif (more details), 2.1 Å
SCOPe Domain Sequences for d3iifb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iifb_ c.50.1.2 (B:) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]} ftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefveav lelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdkk lksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvqe ma
Timeline for d3iifb_: