SCOP 1.73: Domain d1yejh2: 1yej H:114-223

Lineage for d1yejh2 (1yej H:114-223)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1yejh2: 1yej H:114-223 [21171]
   Other proteins in same PDB: d1yejh1, d1yejl1, d1yejl2
   part of Fab D2.3
   complexed with pnp, zn

Details for d1yejh2

PDB Entry: 1yej, 1.85 Å

PDB Description: catalytic antibody complex

PDB Compounds: (H:) protein (ig antibody d2.3 (heavy chain))

SCOP Domain Sequences for d1yejh2:

Sequence; same for both SEQRES and ATOM records:

>d1yejh2 b.1.1.2 (H:114-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1yejh2:

• d1yejh2 first appeared (with stable ids) in SCOP 1.55
  
• d1yejh2 appears in SCOP 1.71
  
• d1yejh2 appears in SCOP 1.75
  
• d1yejh2 appears in the current release, SCOPe 2.08