Lineage for d3ii9c1 (3ii9 C:4-242)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015678Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 3015681Domain d3ii9c1: 3ii9 C:4-242 [211704]
    Other proteins in same PDB: d3ii9a2, d3ii9b2, d3ii9c2, d3ii9d2
    automated match to d1siqa2
    complexed with gol, mg, peg, pg4, pge

Details for d3ii9c1

PDB Entry: 3ii9 (more details), 1.74 Å

PDB Description: Crystal structure of glutaryl-coa dehydrogenase from Burkholderia pseudomallei at 1.73 Angstrom
PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3ii9c1:

Sequence, based on SEQRES records: (download)

>d3ii9c1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3ii9c1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsmvtrarkvpggyslsgskmwitnspiadvfvvwaklde
dgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3ii9c1:

Click to download the PDB-style file with coordinates for d3ii9c1.
(The format of our PDB-style files is described here.)

Timeline for d3ii9c1: