Lineage for d3ii9b1 (3ii9 B:4-242)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1951081Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1951082Protein automated matches [226934] (20 species)
    not a true protein
  7. 1951113Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 1951115Domain d3ii9b1: 3ii9 B:4-242 [211702]
    Other proteins in same PDB: d3ii9a2, d3ii9b2, d3ii9c2, d3ii9d2
    automated match to d1siqa2
    complexed with gol, mg, peg, pg4, pge

Details for d3ii9b1

PDB Entry: 3ii9 (more details), 1.74 Å

PDB Description: Crystal structure of glutaryl-coa dehydrogenase from Burkholderia pseudomallei at 1.73 Angstrom
PDB Compounds: (B:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3ii9b1:

Sequence, based on SEQRES records: (download)

>d3ii9b1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3ii9b1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3ii9b1:

Click to download the PDB-style file with coordinates for d3ii9b1.
(The format of our PDB-style files is described here.)

Timeline for d3ii9b1: