Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries) |
Domain d3ii9a2: 3ii9 A:243-395 [211701] Other proteins in same PDB: d3ii9a1, d3ii9b1, d3ii9c1, d3ii9d1 automated match to d1siqa1 complexed with gol, mg, peg, pg4, pge |
PDB Entry: 3ii9 (more details), 1.74 Å
SCOPe Domain Sequences for d3ii9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ii9a2 a.29.3.0 (A:243-395) automated matches {Burkholderia pseudomallei [TaxId: 320372]} lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar hlvnlevvntyegthdihalilgraqtgiqaff
Timeline for d3ii9a2: