SCOPe 2.06: Domain d3ii6a1: 3ii6 A:1-117

Lineage for d3ii6a1 (3ii6 A:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.59: XRCC4, N-terminal domain [50808] (1 superfamily)
   barrel, closed; n=7, S=10; order: 1234765; strands 1 and 5 are parallel to each other

4. Superfamily b.59.1: XRCC4, N-terminal domain [50809] (1 family)
   an HTH motif connects strands 4 and 5

5. Family b.59.1.1: XRCC4, N-terminal domain [50810] (1 protein)

6. Protein XRCC4, N-terminal domain [50811] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50812] (3 PDB entries)

8. Domain d3ii6a1: 3ii6 A:1-117 [211696]
   Other proteins in same PDB: d3ii6a2, d3ii6b2, d3ii6c2, d3ii6d2
   automated match to d1ik9a1
   protein/DNA complex; complexed with cl

Details for d3ii6a1

PDB Entry: 3ii6, 2.4 Å

PDB Description: structure of human xrcc4 in complex with the tandem brct domains of dna ligaseiv.

PDB Compounds: (A:) DNA repair protein xrcc4

SCOPe Domain Sequences for d3ii6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ii6a1 b.59.1.1 (A:1-117) XRCC4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddme
mekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekve

Timeline for d3ii6a1:

• d3ii6a1 first appeared in SCOPe 2.03
  
• d3ii6a1 appears in SCOPe 2.05
  
• d3ii6a1 appears in SCOPe 2.07
  
• d3ii6a1 appears in the current release, SCOPe 2.08