Lineage for d3ihsb_ (3ihs B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919332Protein automated matches [227011] (2 species)
    not a true protein
  7. 1919333Species Bacillus anthracis [TaxId:198094] [225735] (1 PDB entry)
  8. 1919335Domain d3ihsb_: 3ihs B: [211693]
    automated match to d1zvvj1

Details for d3ihsb_

PDB Entry: 3ihs (more details), 1.15 Å

PDB Description: Crystal Structure of a Phosphocarrier Protein HPr from Bacillus anthracis str. Ames
PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d3ihsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihsb_ d.94.1.1 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
namvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigtg
smitittegsdaeealealaayvq

SCOPe Domain Coordinates for d3ihsb_:

Click to download the PDB-style file with coordinates for d3ihsb_.
(The format of our PDB-style files is described here.)

Timeline for d3ihsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ihsa_