Lineage for d3ihsa1 (3ihs A:1-82)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572528Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2572529Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2572530Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2572619Protein automated matches [227011] (2 species)
    not a true protein
  7. 2572620Species Bacillus anthracis [TaxId:198094] [225735] (1 PDB entry)
  8. 2572621Domain d3ihsa1: 3ihs A:1-82 [211692]
    Other proteins in same PDB: d3ihsa2, d3ihsb2
    automated match to d1zvvj1

Details for d3ihsa1

PDB Entry: 3ihs (more details), 1.15 Å

PDB Description: Crystal Structure of a Phosphocarrier Protein HPr from Bacillus anthracis str. Ames
PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d3ihsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihsa1 d.94.1.1 (A:1-82) automated matches {Bacillus anthracis [TaxId: 198094]}
mvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigtgsm
itittegsdaeealealaayvq

SCOPe Domain Coordinates for d3ihsa1:

Click to download the PDB-style file with coordinates for d3ihsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ihsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ihsa2