SCOPe 2.04: Domain d3ihsa_: 3ihs A:

Lineage for d3ihsa_ (3ihs A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein automated matches [227011] (2 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [225735] (1 PDB entry)

8. Domain d3ihsa_: 3ihs A: [211692]
   automated match to d1zvvj1

Details for d3ihsa_

PDB Entry: 3ihs, 1.15 Å

PDB Description: Crystal Structure of a Phosphocarrier Protein HPr from Bacillus anthracis str. Ames

PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d3ihsa_:

Sequence; same for both SEQRES and ATOM records:

>d3ihsa_ d.94.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
snamvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigt
gsmitittegsdaeealealaayvq

Timeline for d3ihsa_:

• d3ihsa_ first appeared in SCOPe 2.03
  
• d3ihsa_ appears in SCOPe 2.05
  
• d3ihsa_ appears in the current release, SCOPe 2.08, called d3ihsa1