| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
| Protein automated matches [227011] (1 species) not a true protein |
| Species Bacillus anthracis [TaxId:198094] [225735] (1 PDB entry) |
| Domain d3ihsa_: 3ihs A: [211692] automated match to d1zvvj1 |
PDB Entry: 3ihs (more details), 1.15 Å
SCOPe Domain Sequences for d3ihsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihsa_ d.94.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
snamvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigt
gsmitittegsdaeealealaayvq
Timeline for d3ihsa_: