SCOP 1.61: Domain d1pskh2: 1psk H:115-209

Lineage for d1pskh2 (1psk H:115-209)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab against a ganglioside (mouse), kappa L chain [49044] (1 PDB entry)

8. Domain d1pskh2: 1psk H:115-209 [21169]
   Other proteins in same PDB: d1pskh1, d1pskl1

Details for d1pskh2

PDB Entry: 1psk, 2.8 Å

PDB Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside

SCOP Domain Sequences for d1pskh2:

Sequence, based on SEQRES records:

>d1pskh2 b.1.1.2 (H:115-209) Immunoglobulin (constant domains of L and H chains) {Fab against a ganglioside (mouse), kappa L chain}
akttapsvyplapvcgdttgsavtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdk

Sequence, based on observed residues (ATOM records):

>d1pskh2 b.1.1.2 (H:115-209) Immunoglobulin (constant domains of L and H chains) {Fab against a ganglioside (mouse), kappa L chain}
akttapsvyplapvavtlgclvkgyfpepvtltwnssgvhtfpavlqsdlytlsssvtvt
sstwpsqsitcnvahpasstkvdk

Timeline for d1pskh2:

• d1pskh2 first appeared (with stable ids) in SCOP 1.55
  
• d1pskh2 appears in SCOP 1.59
  
• d1pskh2 appears in SCOP 1.63
  
• d1pskh2 appears in the current release, SCOPe 2.08