Lineage for d3ih0b1 (3ih0 B:4-305)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154683Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2154684Protein automated matches [190117] (40 species)
    not a true protein
  7. 2154822Species Pyrococcus horikoshii [TaxId:53953] [225557] (2 PDB entries)
  8. 2154826Domain d3ih0b1: 3ih0 B:4-305 [211684]
    Other proteins in same PDB: d3ih0a2, d3ih0b2
    automated match to d2fv7a1
    complexed with anp, gol

Details for d3ih0b1

PDB Entry: 3ih0 (more details), 1.9 Å

PDB Description: crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
PDB Compounds: (B:) Uncharacterized sugar kinase PH1459

SCOPe Domain Sequences for d3ih0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ih0b1 c.72.1.0 (B:4-305) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
iasigellidlisveegdlkdvrlfekhpggapanvavgvsrlgvkssliskvgndpfge
ylieelskenvdtrgivkdekkhtgivfvqlkgaspsfllyddvayfnmtlndinwdive
eakivnfgsvilarnpsretvmkvikkikgssliafdvnlrldlwrgqeeemikvleesi
kladivkaseeevlylenqgvevkgsmltaitlgpkgfrliknetvvdvpsynvnpldtt
gagdafmaallvgilklkgldllklgkfanlvaalstqkrgawstprkdellkykearev
la

SCOPe Domain Coordinates for d3ih0b1:

Click to download the PDB-style file with coordinates for d3ih0b1.
(The format of our PDB-style files is described here.)

Timeline for d3ih0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ih0b2