Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (27 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries) |
Domain d3igub2: 3igu B:310-404 [211682] Other proteins in same PDB: d3igua1, d3igub1 automated match to d1ktba1 complexed with 7jz, gol, nag |
PDB Entry: 3igu (more details), 2.15 Å
SCOPe Domain Sequences for d3igub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3igub2 b.71.1.0 (B:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq dvysgdiisglrdetnftviinpsgvvmwylypik
Timeline for d3igub2: