Lineage for d3igub2 (3igu B:310-404)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. 1556269Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries)
  8. 1556284Domain d3igub2: 3igu B:310-404 [211682]
    Other proteins in same PDB: d3igua1, d3igub1
    automated match to d1ktba1
    complexed with 7jz, gol, nag

Details for d3igub2

PDB Entry: 3igu (more details), 2.15 Å

PDB Description: crystal structure of human alpha-n-acetylgalactosaminidase, covalent intermediate
PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d3igub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igub2 b.71.1.0 (B:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

SCOPe Domain Coordinates for d3igub2:

Click to download the PDB-style file with coordinates for d3igub2.
(The format of our PDB-style files is described here.)

Timeline for d3igub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3igub1