Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
Domain d3igac_: 3iga C: [211678] Other proteins in same PDB: d3igaa1, d3igaa2, d3igaa3, d3igab1, d3igab2 automated match to d1r3jc_ complexed with dga, ni |
PDB Entry: 3iga (more details), 2.75 Å
SCOPe Domain Sequences for d3igac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3igac_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d3igac_: