Lineage for d1qkzh2 (1qkz H:114-213)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53882Species Fab MN14C11.6 (mouse), kappa L chain [49043] (1 PDB entry)
  8. 53883Domain d1qkzh2: 1qkz H:114-213 [21167]
    Other proteins in same PDB: d1qkza_, d1qkzh1, d1qkzl1

Details for d1qkzh2

PDB Entry: 1qkz (more details), 1.95 Å

PDB Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g

SCOP Domain Sequences for d1qkzh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkzh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Fab MN14C11.6 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvnvtsstwpsqsitcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1qkzh2:

Click to download the PDB-style file with coordinates for d1qkzh2.
(The format of our PDB-style files is described here.)

Timeline for d1qkzh2: