Lineage for d3ifhx1 (3ifh X:5-484)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157920Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2157921Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2158358Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2158359Protein automated matches [190683] (49 species)
    not a true protein
  7. 2158490Species Burkholderia pseudomallei [TaxId:320372] [225734] (2 PDB entries)
  8. 2158520Domain d3ifhx1: 3ifh X:5-484 [211659]
    Other proteins in same PDB: d3ifh12, d3ifh22, d3ifh32, d3ifh42, d3ifh52, d3ifh62, d3ifhq2, d3ifhr2, d3ifhs2, d3ifht2, d3ifhu2, d3ifhv2, d3ifhw2, d3ifhx2, d3ifhy2, d3ifhz2

Details for d3ifhx1

PDB Entry: 3ifh (more details), 2.7 Å

PDB Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 2 of 2
PDB Compounds: (X:) Succinate-semialdehyde dehydrogenase (NADP+)

SCOPe Domain Sequences for d3ifhx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ifhx1 c.82.1.0 (X:5-484) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaawa
gwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfaee
gkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvkpa
estpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrllm
aqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvhervy
dafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkrha
lghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylysrd
igrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcvav

SCOPe Domain Coordinates for d3ifhx1:

Click to download the PDB-style file with coordinates for d3ifhx1.
(The format of our PDB-style files is described here.)

Timeline for d3ifhx1: