![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [225734] (4 PDB entries) |
![]() | Domain d3ifgn1: 3ifg N:5-484 [211643] Other proteins in same PDB: d3ifga2, d3ifgb2, d3ifgc2, d3ifgd2, d3ifge2, d3ifgf2, d3ifgg2, d3ifgh2, d3ifgi2, d3ifgj2, d3ifgk2, d3ifgl2, d3ifgm2, d3ifgn2, d3ifgo2, d3ifgp2 |
PDB Entry: 3ifg (more details), 2.7 Å
SCOPe Domain Sequences for d3ifgn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ifgn1 c.82.1.0 (N:5-484) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaawa gwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfaee gkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvkpa estpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrllm aqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvhervy dafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkrha lghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylysrd igrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcvav
Timeline for d3ifgn1:
![]() Domains from other chains: (mouse over for more information) d3ifga1, d3ifga2, d3ifgb1, d3ifgb2, d3ifgc1, d3ifgc2, d3ifgd1, d3ifgd2, d3ifge1, d3ifge2, d3ifgf1, d3ifgf2, d3ifgg1, d3ifgg2, d3ifgh1, d3ifgh2, d3ifgi1, d3ifgi2, d3ifgj1, d3ifgj2, d3ifgk1, d3ifgk2, d3ifgl1, d3ifgl2, d3ifgm1, d3ifgm2, d3ifgo1, d3ifgo2, d3ifgp1, d3ifgp2 |