Lineage for d3ifgn1 (3ifg N:5-484)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909154Species Burkholderia pseudomallei [TaxId:320372] [225734] (4 PDB entries)
  8. 2909171Domain d3ifgn1: 3ifg N:5-484 [211643]
    Other proteins in same PDB: d3ifga2, d3ifgb2, d3ifgc2, d3ifgd2, d3ifge2, d3ifgf2, d3ifgg2, d3ifgh2, d3ifgi2, d3ifgj2, d3ifgk2, d3ifgl2, d3ifgm2, d3ifgn2, d3ifgo2, d3ifgp2

Details for d3ifgn1

PDB Entry: 3ifg (more details), 2.7 Å

PDB Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 1 of 2
PDB Compounds: (N:) Succinate-semialdehyde dehydrogenase (NADP+)

SCOPe Domain Sequences for d3ifgn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ifgn1 c.82.1.0 (N:5-484) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaawa
gwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfaee
gkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvkpa
estpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrllm
aqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvhervy
dafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkrha
lghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylysrd
igrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcvav

SCOPe Domain Coordinates for d3ifgn1:

Click to download the PDB-style file with coordinates for d3ifgn1.
(The format of our PDB-style files is described here.)

Timeline for d3ifgn1: