SCOPe 2.08: Domain d3ifgh1: 3ifg H:5-484

Lineage for d3ifgh1 (3ifg H:5-484)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (61 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [225734] (4 PDB entries)

8. Domain d3ifgh1: 3ifg H:5-484 [211637]
   Other proteins in same PDB: d3ifga2, d3ifgb2, d3ifgc2, d3ifgd2, d3ifge2, d3ifgf2, d3ifgg2, d3ifgh2, d3ifgi2, d3ifgj2, d3ifgk2, d3ifgl2, d3ifgm2, d3ifgn2, d3ifgo2, d3ifgp2

Details for d3ifgh1

PDB Entry: 3ifg, 2.7 Å

PDB Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 1 of 2

PDB Compounds: (H:) Succinate-semialdehyde dehydrogenase (NADP+)

SCOPe Domain Sequences for d3ifgh1:

Sequence; same for both SEQRES and ATOM records:

>d3ifgh1 c.82.1.0 (H:5-484) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaawa
gwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfaee
gkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvkpa
estpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrllm
aqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvhervy
dafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkrha
lghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylysrd
igrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcvav

Timeline for d3ifgh1:

• d3ifgh1 first appeared in SCOPe 2.03, called d3ifgh_
  
• d3ifgh1 appears in SCOPe 2.07