Lineage for d3if1a1 (3if1 A:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744623Domain d3if1a1: 3if1 A:2-107 [211623]
    Other proteins in same PDB: d3if1a2, d3if1c2
    complexed with mg, nga, zn

Details for d3if1a1

PDB Entry: 3if1 (more details), 2.39 Å

PDB Description: crystal structure of 237mab in complex with a galnac
PDB Compounds: (A:) Immunoglobulin light chain (IgG2a)

SCOPe Domain Sequences for d3if1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3if1a1 b.1.1.1 (A:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqltqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleik

SCOPe Domain Coordinates for d3if1a1:

Click to download the PDB-style file with coordinates for d3if1a1.
(The format of our PDB-style files is described here.)

Timeline for d3if1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3if1a2