Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.332: RGC domain-like [143884] (1 superfamily) consists of two beta-sheets and four helices eclosing a cental cavity |
Superfamily d.332.1: RGC domain-like [143885] (1 family) |
Family d.332.1.1: RGC domain [143886] (2 proteins) Pfam PF03836; RasGAP C-terminus |
Protein automated matches [227022] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225779] (2 PDB entries) |
Domain d3iezb_: 3iez B: [211622] automated match to d1x0ha1 complexed with unx |
PDB Entry: 3iez (more details), 1.5 Å
SCOPe Domain Sequences for d3iezb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iezb_ d.332.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpvkytaaklhekgvlldiddlqtnqfknvtfdiiatedvgifdvrskflgvemekvqln iqdllqmqyegvavmkmfdkvkvnvnlliyllnkk
Timeline for d3iezb_: