![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein GTPase Era C-terminal domain [54818] (3 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224928] (1 PDB entry) |
![]() | Domain d3ieub2: 3ieu B:183-296 [211620] Other proteins in same PDB: d3ieua1, d3ieub1 automated match to d1egab2 protein/RNA complex; complexed with gdp, so4, trs |
PDB Entry: 3ieu (more details), 2.8 Å
SCOPe Domain Sequences for d3ieub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ieub2 d.52.3.1 (B:183-296) GTPase Era C-terminal domain {Escherichia coli K-12 [TaxId: 83333]} dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg
Timeline for d3ieub2: