SCOPe 2.08: Domain d3ieub2: 3ieu B:183-296

Lineage for d3ieub2 (3ieu B:183-296)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein GTPase Era C-terminal domain [54818] (3 species)

7. Species Escherichia coli K-12 [TaxId:83333] [224928] (1 PDB entry)

8. Domain d3ieub2: 3ieu B:183-296 [211620]
   Other proteins in same PDB: d3ieua1, d3ieub1
   automated match to d1egab2
   protein/RNA complex; complexed with gdp, so4, trs

Details for d3ieub2

PDB Entry: 3ieu, 2.8 Å

PDB Description: crystal structure of era in complex with gdp

PDB Compounds: (B:) GTP-binding protein era

SCOPe Domain Sequences for d3ieub2:

Sequence; same for both SEQRES and ATOM records:

>d3ieub2 d.52.3.1 (B:183-296) GTPase Era C-terminal domain {Escherichia coli K-12 [TaxId: 83333]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg

Timeline for d3ieub2:

• d3ieub2 first appeared in SCOPe 2.03
  
• d3ieub2 appears in SCOPe 2.07