SCOP 1.67: Domain d1afvm2: 1afv M:113-217

Lineage for d1afvm2 (1afv M:113-217)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

Domain d1afvm2: 1afv M:113-217 [21162]
Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvm1
part of Fab 25.3 against HIV-1 capsid protein (p24)
complexed with pb

Details for d1afvm2

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvm2 b.1.1.2 (M:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1afvm2:

Click to download the PDB-style file with coordinates for d1afvm2.
(The format of our PDB-style files is described here.)

Timeline for d1afvm2: