Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein GTPase Era C-terminal domain [54818] (3 species) |
Species Escherichia coli K-12 [TaxId:83333] [224928] (1 PDB entry) |
Domain d3ieua2: 3ieu A:183-296 [211618] Other proteins in same PDB: d3ieua1, d3ieub1 automated match to d1egab2 protein/RNA complex; complexed with gdp, so4, trs |
PDB Entry: 3ieu (more details), 2.8 Å
SCOPe Domain Sequences for d3ieua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ieua2 d.52.3.1 (A:183-296) GTPase Era C-terminal domain {Escherichia coli K-12 [TaxId: 83333]} dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg
Timeline for d3ieua2: