Lineage for d1afvh2 (1afv H:121-220)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221224Species Fab 25.3 (mouse), kappa L chain [49041] (1 PDB entry)
    against HIV-1 capsid protein (p24)
  8. 221225Domain d1afvh2: 1afv H:121-220 [21161]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvm1

Details for d1afvh2

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvh2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk

SCOP Domain Coordinates for d1afvh2:

Click to download the PDB-style file with coordinates for d1afvh2.
(The format of our PDB-style files is described here.)

Timeline for d1afvh2: