Lineage for d3ieid_ (3iei D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146764Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)
  8. 2146768Domain d3ieid_: 3iei D: [211608]
    automated match to d1rjdb_
    complexed with gol, mes, sah

Details for d3ieid_

PDB Entry: 3iei (more details), 1.9 Å

PDB Description: crystal structure of human leucine carboxylmethyltransferase-1 in complex with s-adenosyl homocysteine
PDB Compounds: (D:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d3ieid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieid_ c.66.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvrgtcedaslckrfavsigywhdpyiqhfvrlskerkapeinrgyfarvhgvsqlikaf
lrktechcqivnlgagmdttfwrlkdedllsskyfevdfpmivtrklhsikckpplsspi
lelhsedtlqmdghildskryavigadlrdlseleeklkkcnmntqlptlliaecvlvym
tpeqsanllkwaansferamfinyeqvnmgdrfgqimienlrrrqcdlagvetckslesq
kerllsngwetasavdmmelynrlpraevsrieslefldemelleqlmrhyclcwatkgg
nelglkeity

SCOPe Domain Coordinates for d3ieid_:

Click to download the PDB-style file with coordinates for d3ieid_.
(The format of our PDB-style files is described here.)

Timeline for d3ieid_: