SCOP 1.55: Domain d1afvl2: 1afv L:113-217

Lineage for d1afvl2 (1afv L:113-217)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 25.3 (mouse), kappa L chain [49041] (1 PDB entry)

8. Domain d1afvl2: 1afv L:113-217 [21160]
   Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvm1

Details for d1afvl2

PDB Entry: 1afv, 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvl2:

Sequence; same for both SEQRES and ATOM records:

>d1afvl2 b.1.1.2 (L:113-217) Immunoglobulin (constant domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1afvl2:

• d1afvl2 appears in SCOP 1.57
  
• d1afvl2 appears in the current release, SCOPe 2.08