Lineage for d3idsb1 (3ids B:1-164,B:334-359)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1829061Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries)
  8. 1829063Domain d3idsb1: 3ids B:1-164,B:334-359 [211592]
    Other proteins in same PDB: d3idsa2, d3idsb2, d3idsc2, d3idsd2
    automated match to d1k3ta1
    complexed with acm, gol, nad

Details for d3idsb1

PDB Entry: 3ids (more details), 1.8 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in complex with the irreversible iodoacetamide inhibitor
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d3idsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3idsb1 c.2.1.3 (B:1-164,B:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOPe Domain Coordinates for d3idsb1:

Click to download the PDB-style file with coordinates for d3idsb1.
(The format of our PDB-style files is described here.)

Timeline for d3idsb1: