SCOPe 2.06: Domain d3idga1: 3idg A:1-107

Lineage for d3idga1 (3idg A:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (61 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d3idga1: 3idg A:1-107 [211576]
   Other proteins in same PDB: d3idga2
   automated match to d2f5bl1

Details for d3idga1

PDB Entry: 3idg, 1.86 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide aldkwd

PDB Compounds: (A:) 2F5 Fab light chain

SCOPe Domain Sequences for d3idga1:

Sequence; same for both SEQRES and ATOM records:

>d3idga1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d3idga1:

• d3idga1 first appeared in SCOPe 2.03
  
• d3idga1 appears in SCOPe 2.05
  
• d3idga1 appears in SCOPe 2.07
  
• d3idga1 appears in the current release, SCOPe 2.08