Lineage for d3id8a2 (3id8 A:219-457)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858644Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)
  8. 1858723Domain d3id8a2: 3id8 A:219-457 [211575]
    automated match to d1bdga2
    complexed with anp, glc, k, mg, mrk

Details for d3id8a2

PDB Entry: 3id8 (more details), 2.4 Å

PDB Description: ternary complex of human pancreatic glucokinase crystallized with activator, glucose and amp-pnp
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3id8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3id8a2 c.55.1.0 (A:219-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavac

SCOPe Domain Coordinates for d3id8a2:

Click to download the PDB-style file with coordinates for d3id8a2.
(The format of our PDB-style files is described here.)

Timeline for d3id8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3id8a1