Lineage for d3icma_ (3icm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2338166Species Trypanosoma cruzi [TaxId:5693] [196823] (14 PDB entries)
  8. 2338177Domain d3icma_: 3icm A: [211570]
    automated match to d4dwba_
    complexed with ipe, mg, p2h, so4

Details for d3icma_

PDB Entry: 3icm (more details), 2.2 Å

PDB Description: trypanosoma cruzi farnesyl diphosphate synthase homodimer in complex with isopentenyl pyrophosphate, mg2+ and 1-(2-hydroxy-2,2-bis- phosphono-ethyl)-3-phenyl-pyridinium
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3icma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3icma_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

SCOPe Domain Coordinates for d3icma_:

Click to download the PDB-style file with coordinates for d3icma_.
(The format of our PDB-style files is described here.)

Timeline for d3icma_: