SCOP 1.69: Domain d1ad0d2: 1ad0 D:114-211

Lineage for d1ad0d2 (1ad0 D:114-211)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1ad0d2: 1ad0 D:114-211 [21157]
Other proteins in same PDB: d1ad0a1, d1ad0a2, d1ad0b1, d1ad0c1, d1ad0c2, d1ad0d1
part of humanized Fab A5B7

Details for d1ad0d2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0d2 b.1.1.2 (D:114-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve

SCOP Domain Coordinates for d1ad0d2:

Click to download the PDB-style file with coordinates for d1ad0d2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0d2: