Lineage for d3icka_ (3ick A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282310Species Trypanosoma cruzi [TaxId:5693] [196823] (13 PDB entries)
  8. 1282318Domain d3icka_: 3ick A: [211569]
    automated match to d4dwba_
    complexed with acy, ipe, m0n, mg, so4

Details for d3icka_

PDB Entry: 3ick (more details), 2.4 Å

PDB Description: trypanosoma cruzi farnesyl diphosphate synthase homodimer in complex with minodronate and isopentenyl disphosphate
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3icka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3icka_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

SCOPe Domain Coordinates for d3icka_:

Click to download the PDB-style file with coordinates for d3icka_.
(The format of our PDB-style files is described here.)

Timeline for d3icka_: