Lineage for d3ibea1 (3ibe A:144-322)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178530Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2178550Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2178551Species Human (Homo sapiens) [TaxId:9606] [54276] (65 PDB entries)
  8. 2178583Domain d3ibea1: 3ibe A:144-322 [211565]
    Other proteins in same PDB: d3ibea2, d3ibea3, d3ibea4, d3ibea5
    automated match to d1e8ya3
    complexed with l64, so4

Details for d3ibea1

PDB Entry: 3ibe (more details), 2.8 Å

PDB Description: crystal structure of a pyrazolopyrimidine inhibitor bound to pi3 kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3ibea1:

Sequence, based on SEQRES records: (download)

>d3ibea1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

Sequence, based on observed residues (ATOM records): (download)

>d3ibea1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

SCOPe Domain Coordinates for d3ibea1:

Click to download the PDB-style file with coordinates for d3ibea1.
(The format of our PDB-style files is described here.)

Timeline for d3ibea1: