Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries) |
Domain d3i8ta_: 3i8t A: [211548] automated match to d2dyca_ complexed with gol, na, peg |
PDB Entry: 3i8t (more details), 2.1 Å
SCOPe Domain Sequences for d3i8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i8ta_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadvafhfnprfdgwd kvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsfyeyghrlpvqm vthlqvdgdlelqsinflgg
Timeline for d3i8ta_: