Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries) |
Domain d3i8pa1: 3i8p A:2-251 [211546] automated match to d1e5ma1 complexed with 840 |
PDB Entry: 3i8p (more details), 1.9 Å
SCOPe Domain Sequences for d3i8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i8pa1 c.95.1.0 (A:2-251) automated matches {Escherichia coli K-12 [TaxId: 83333]} krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl mnggprkispffvpstivnmvaghltimyglrgpsisiataatsgvhnighaariiaygd advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle eyehakkrga
Timeline for d3i8pa1: