SCOPe 2.04: Domain d3i6yb_: 3i6y B:

Lineage for d3i6yb_ (3i6y B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Oleispira antarctica [TaxId:188908] [196342] (2 PDB entries)

8. Domain d3i6yb_: 3i6y B: [211541]
   automated match to d3s8ya_
   complexed with cl, edo, peg

Details for d3i6yb_

PDB Entry: 3i6y, 1.75 Å

PDB Description: structure of an esterase from the oil-degrading bacterium oleispira antarctica

PDB Compounds: (B:) Esterase APC40077

SCOPe Domain Sequences for d3i6yb_:

Sequence; same for both SEQRES and ATOM records:

>d3i6yb_ c.69.1.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
sienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsden
fmqkagaqrlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyqmy
dyvvnelpeliesmfpvsdkraiaghsmgghgaltialrnperyqsvsafspinnpvncp
wgqkaftaylgkdtdtwreydasllmraakqyvpalvdqgeadnflaeqlkpevleaaas
snnyplelrshegydhsyyfiasfiedhlrfhsnylna

Timeline for d3i6yb_:

• d3i6yb_ first appeared in SCOPe 2.03
  
• d3i6yb_ appears in SCOPe 2.05
  
• d3i6yb_ appears in the current release, SCOPe 2.08