Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab A5B7 (engineered human construct), kappa L chain [49039] (1 PDB entry) |
Domain d1ad0a2: 1ad0 A:108-213 [21154] Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0c1, d1ad0d1 |
PDB Entry: 1ad0 (more details), 2.5 Å
SCOP Domain Sequences for d1ad0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad0a2 b.1.1.2 (A:108-213) Immunoglobulin (constant domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain} tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1ad0a2: